PDB entry 1afu

View 1afu on RCSB PDB site
Description: structure of ribonuclease a at 2.0 angstroms from monoclinic crystals
Class: hydrolase
Keywords: hydrolase, ribonuclease, endonuclease
Deposited on 1997-03-14, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afua_
  • Chain 'B':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afuA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afuB (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv