PDB entry 1afs

View 1afs on RCSB PDB site
Description: recombinant rat liver 3-alpha-hydroxysteroid dehydrogenase (3-alpha-hsd) complexed with nadp and testosterone
Class: oxidoreductase
Keywords: oxidoreductase, nad
Deposited on 1997-03-13, released 1997-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-alpha-hydroxysteroid dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afsa_
  • Chain 'B':
    Compound: 3-alpha-hydroxysteroid dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afsb_
  • Heterogens: NAP, TES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1afsA (A:)
    mdsislrvalndgnfipvlgfgttvpekvakdevikatkiaidngfrhfdsaylyeveee
    vgqairskiedgtvkredifytsklwstfhrpelvrtclektlkstqldyvdlyiihfpm
    alqpgdiffprdehgkllfetvdicdtweamekckdaglaksigvsnfncrqlerilnkp
    glkykpvcnqvechlylnqskmldyckskdiilvsyctlgssrdktwvdqkspvllddpv
    lcaiakkykqtpalvalryqlqrgvvplirsfnakrikeltqvfefqlasedmkaldgln
    rnfrynnakyfddhpnhpftden
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afsA (A:)
    mdsislrvalndgnfipvlgfgttvpekvakdevikatkiaidngfrhfdsaylyeveee
    vgqairskiedgtvkredifytsklwstfhrpelvrtclektlkstqldyvdlyiihfpm
    alqpgdiffprdehgkllfetvdicdtweamekckdaglaksigvsnfncrqlerilnkp
    glkykpvcnqvechlylnqskmldyckskdiilvsyctlgssrdktwvdqkspvllddpv
    lcaiakkykqtpalvalryqlqrgvvplirsfnakrikeltqvfefqlasedmkaldgln
    rnfrynnakyfddhpnhpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1afsB (B:)
    mdsislrvalndgnfipvlgfgttvpekvakdevikatkiaidngfrhfdsaylyeveee
    vgqairskiedgtvkredifytsklwstfhrpelvrtclektlkstqldyvdlyiihfpm
    alqpgdiffprdehgkllfetvdicdtweamekckdaglaksigvsnfncrqlerilnkp
    glkykpvcnqvechlylnqskmldyckskdiilvsyctlgssrdktwvdqkspvllddpv
    lcaiakkykqtpalvalryqlqrgvvplirsfnakrikeltqvfefqlasedmkaldgln
    rnfrynnakyfddhpnhpftden
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afsB (B:)
    mdsislrvalndgnfipvlgfgttvpekvakdevikatkiaidngfrhfdsaylyeveee
    vgqairskiedgtvkredifytsklwstfhrpelvrtclektlkstqldyvdlyiihfpm
    alqpgdiffprdehgkllfetvdicdtweamekckdaglaksigvsnfncrqlerilnkp
    glkykpvcnqvechlylnqskmldyckskdiilvsyctlgssrdktwvdqkspvllddpv
    lcaiakkykqtpalvalryqlqrgvvplirsfnakrikeltqvfefqlasedmkaldgln
    rnfrynnakyfddhpnhpf