PDB entry 1afr

View 1afr on RCSB PDB site
Description: stearoyl-acyl carrier protein desaturase from castor seeds
Class: oxidoreductase
Keywords: oxidoreductase, fatty acid desaturase, fatty acid biosynthesis, binuclear iron center, electron transfer
Deposited on 1997-03-13, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta9 stearoyl-acyl carrier protein desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afra_
  • Chain 'B':
    Compound: delta9 stearoyl-acyl carrier protein desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afrb_
  • Chain 'C':
    Compound: delta9 stearoyl-acyl carrier protein desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afrc_
  • Chain 'D':
    Compound: delta9 stearoyl-acyl carrier protein desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afrd_
  • Chain 'E':
    Compound: delta9 stearoyl-acyl carrier protein desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afre_
  • Chain 'F':
    Compound: delta9 stearoyl-acyl carrier protein desaturase
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1afrf_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afrA (A:)
    mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde
    qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra
    wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera
    tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm
    mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa
    egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afrB (B:)
    mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde
    qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra
    wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera
    tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm
    mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa
    egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afrC (C:)
    mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde
    qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra
    wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera
    tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm
    mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa
    egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afrD (D:)
    mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde
    qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra
    wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera
    tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm
    mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa
    egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afrE (E:)
    mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde
    qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra
    wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera
    tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm
    mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa
    egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afrF (F:)
    mpprevhvqvthsmppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfde
    qvrelrerakeipddyfvvlvgdmiteealptyqtmlntldgvrdetgasptswaiwtra
    wtaeenrhgdllnkylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqera
    tfishgntarqakehgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadm
    mrkkismpahlmydgrddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsa
    egqkaqdyvcrlpprirrleeraqgrakeaptmpfswifdrqvkl