PDB entry 1afp

View 1afp on RCSB PDB site
Description: solution structure of the antifungal protein from aspergillus giganteus. evidence for disulphide configurational isomerism
Class: antifungal protein
Keywords: antifungal protein
Deposited on 1994-11-11, released 1995-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antifungal protein from aspergillus giganteus
    Species: Aspergillus giganteus [TaxId:5060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1afpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1afpA (A:)
    atyngkcykkdnickykaqsgktaickcyvkkcprdgakcefdsykgkcyc