PDB entry 1afo

View 1afo on RCSB PDB site
Description: dimeric transmembrane domain of human glycophorin a, nmr, 20 structures
Deposited on 1997-03-11, released 1997-09-17
The last revision was dated 2021-10-27, with a file datestamp of 2021-10-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycophorin a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: glycophorin a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1afoA (A:)
vqlahhfsepeitliifgvmagvigtillisygirrlikk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1afoB (B:)
vqlahhfsepeitliifgvmagvigtillisygirrlikk