PDB entry 1afn

View 1afn on RCSB PDB site
Description: x-ray structure and site-directed mutagenesis of a nitrite reductase from alcaligenes faecalis s-6; role of two copper atoms in nitrite reduction
Deposited on 1993-12-27, released 1994-04-30
The last revision was dated 1994-04-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.176
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Chain 'C':
    no info in PDB for this chain
  • Heterogens: CU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1afnA (A:)
    alprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtvpg
    plmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatkpg
    vfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfyvprden
    gkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvlivhsqanr
    dtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayvnhnlie
    afelgaaahfkvtgewnddlmtsvlapsgt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1afnB (B:)
    alprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtvpg
    plmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatkpg
    vfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfyvprden
    gkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvlivhsqanr
    dtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayvnhnlie
    afelgaaahfkvtgewnddlmtsvlapsgt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1afnC (C:)
    alprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtvpg
    plmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatkpg
    vfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdfyvprden
    gkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvlivhsqanr
    dtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayvnhnlie
    afelgaaahfkvtgewnddlmtsvlapsgt