PDB entry 1afl

View 1afl on RCSB PDB site
Description: ribonuclease a in complex with 5'-diphosphoadenosine 2'-phosphate at 1.7 angstrom resolution
Class: hydrolase
Keywords: hydrolase, ribonuclease, endonuclease, nucleotide inhibitor
Deposited on 1997-03-08, released 1998-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.217
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1afla_
  • Chain 'B':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aflb_
  • Heterogens: ATR, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aflA (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aflB (B:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv