PDB entry 1afj

View 1afj on RCSB PDB site
Description: structure of the mercury-bound form of merp, the periplasmic protein from the bacterial mercury detoxification system, nmr, 20 structures
Class: mercury detoxification
Keywords: mercury detoxification, periplasmic, heavy metal transport, alpha-beta sandwich
Deposited on 1997-03-07, released 1997-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: merp
    Species: Shigella flexneri [TaxId:623]
    Gene: MERP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1afja_
  • Heterogens: HG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1afjA (A:)
atqtvtlavpgmtcaacpitvkkalskvegvskvdvgfekreavvtfddtkasvqkltka
tadagypssvkq