PDB entry 1afh

View 1afh on RCSB PDB site
Description: lipid transfer protein from maize seedlings, nmr, 15 structures
Class: lipid-binding protein
Keywords: lipid-binding protein, lipid transfer protein, maize, molecular modeling, nmr
Deposited on 1997-03-07, released 1997-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: maize nonspecific lipid transfer protein
  Species: Zea mays [TaxId:4577]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19656 (0-92)
  Domains in SCOPe 2.08: d1afha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1afhA (A:)
  aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv
  sglnagnaasipskcgvsipytiststdcsrvn