PDB entry 1afg

View 1afg on RCSB PDB site
Description: 2.0 angstrom structure of human acidic fibroblast growth factor
Deposited on 1993-12-28, released 1994-06-22
The last revision was dated 1994-06-22, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Chain 'C':
    no info in PDB for this chain
  • Chain 'D':
    no info in PDB for this chain
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1afgA (A:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records):
    >1afgA (A:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1afgB (B:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records):
    >1afgB (B:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvs
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1afgC (C:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records):
    >1afgC (C:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1afgD (D:)
    fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records):
    >1afgD (D:)
    pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
    gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
    lflplpvs