PDB entry 1afc

View 1afc on RCSB PDB site
Description: structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor
Class: growth factor
Keywords: growth factor
Deposited on 1993-07-13, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968
      • conflict (46)
    Domains in SCOPe 2.05: d1afca_
  • Chain 'B':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968
      • conflict (46)
    Domains in SCOPe 2.05: d1afcb_
  • Chain 'C':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968
      • conflict (46)
    Domains in SCOPe 2.05: d1afcc_
  • Chain 'D':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968
      • conflict (46)
    Domains in SCOPe 2.05: d1afcd_
  • Chain 'E':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968
      • conflict (46)
    Domains in SCOPe 2.05: d1afce_
  • Chain 'F':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968
      • conflict (46)
    Domains in SCOPe 2.05: d1afcf_
  • Chain 'G':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968
      • conflict (46)
    Domains in SCOPe 2.05: d1afcg_
  • Chain 'H':
    Compound: acidic fibroblast growth factor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03968
      • conflict (46)
    Domains in SCOPe 2.05: d1afch_
  • Heterogens: SCR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1afcA (A:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afcA (A:)
    kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
    dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
    ilflplp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1afcB (B:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afcB (B:)
    kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
    dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
    ilflplp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1afcC (C:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afcC (C:)
    kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
    dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
    ilflplp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1afcD (D:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afcD (D:)
    kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
    dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
    ilflplp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1afcE (E:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afcE (E:)
    kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
    dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
    ilflplp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1afcF (F:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afcF (F:)
    kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
    dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
    ilflplp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1afcG (G:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afcG (G:)
    kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
    dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
    ilflplp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1afcH (H:)
    fnlplgnykkpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikste
    tgqflamdtdgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklg
    prthfgqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1afcH (H:)
    kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
    dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
    ilflplp