PDB entry 1af9

View 1af9 on RCSB PDB site
Description: tetanus neurotoxin c fragment
Class: clostridial neurotoxin
Keywords: clostridial neurotoxin, tetanus, receptor binding
Deposited on 1997-03-24, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.161
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetanus neurotoxin
    Species: Clostridium tetani [TaxId:1513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1af9a1, d1af9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1af9A (A:)
    mknldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkai
    hlvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkh
    slsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlss
    anlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiek
    lytsylsitflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngkln
    iyyrrlynglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldr
    ilrvgynapgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdi
    liasnwyfnhlkdkilgcdwyfvptdegwtnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1af9A (A:)
    edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
    vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
    lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
    saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsylsitfl
    rdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrlynglk
    fiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgynapgi
    plykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwyfnhl
    kdkilgcdwyfvptdegwtnd