PDB entry 1af7

View 1af7 on RCSB PDB site
Description: cher from salmonella typhimurium
Class: methyltransferase
Keywords: methyltransferase, chemotaxis receptor methylation
Deposited on 1997-03-22, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis receptor methyltransferase cher
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1af7a1, d1af7a2
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1af7A (A:)
    svllqmtqrlalsdahfrricqliyqragivladhkrdmvynrlvrrlralglddfgryl
    smleanqnsaewqafinalttnltaffreahhfpilaeharrrhgeyrvwsaaastgeep
    ysiaitladalgmapgrwkvfasdidtevlekarsgiyrlselktlspqqlqryfmrgtg
    pheglvrvrqelanyvefssvnllekqynvpgpfdaifcrnvmiyfdkttqedilrrfvp
    llkpdgllfaghsenfsnlvrefslrgqtvyals