PDB entry 1af6

View 1af6 on RCSB PDB site
Description: maltoporin sucrose complex
Class: membrane protein
Keywords: membrane protein, specific porin, beta barrel, sugar transport, sucrose
Deposited on 1997-03-21, released 1998-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltoporin
    Species: Escherichia coli [TaxId:562]
    Gene: LAMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1af6a_
  • Chain 'B':
    Compound: maltoporin
    Species: Escherichia coli [TaxId:562]
    Gene: LAMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1af6b_
  • Chain 'C':
    Compound: maltoporin
    Species: Escherichia coli [TaxId:562]
    Gene: LAMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1af6c_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1af6A (A:)
    vdfhgyarsgigwtgsggeqqcfqttgaqskyrlgnecetyaelklgqevwkegdksfyf
    dtnvaysvaqqndweatdpafreanvqgknliewlpgstiwagkrfyqrhdvhmidfyyw
    disgpgaglenidvgfgklslaatrsseaggsssfasnniydytnetandvfdvrlaqme
    inpggtlelgvdygranlrdnyrlvdgaskdgwlftaehtqsvlkgfnkfvvqyatdsmt
    sqgkglsqgsgvafdnekfayninnnghmlrildhgaismgdnwdmmyvgmyqdinwdnd
    ngtkwwtvgirpmykwtpimstvmeigydnvesqrtgdknnqykitlaqqwqagdsiwsr
    pairvfatyakwdekwgydytgnadnnanfgkavpadfnggsfgrgdsdewtfgaqmeiw
    w
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1af6B (B:)
    vdfhgyarsgigwtgsggeqqcfqttgaqskyrlgnecetyaelklgqevwkegdksfyf
    dtnvaysvaqqndweatdpafreanvqgknliewlpgstiwagkrfyqrhdvhmidfyyw
    disgpgaglenidvgfgklslaatrsseaggsssfasnniydytnetandvfdvrlaqme
    inpggtlelgvdygranlrdnyrlvdgaskdgwlftaehtqsvlkgfnkfvvqyatdsmt
    sqgkglsqgsgvafdnekfayninnnghmlrildhgaismgdnwdmmyvgmyqdinwdnd
    ngtkwwtvgirpmykwtpimstvmeigydnvesqrtgdknnqykitlaqqwqagdsiwsr
    pairvfatyakwdekwgydytgnadnnanfgkavpadfnggsfgrgdsdewtfgaqmeiw
    w
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1af6C (C:)
    vdfhgyarsgigwtgsggeqqcfqttgaqskyrlgnecetyaelklgqevwkegdksfyf
    dtnvaysvaqqndweatdpafreanvqgknliewlpgstiwagkrfyqrhdvhmidfyyw
    disgpgaglenidvgfgklslaatrsseaggsssfasnniydytnetandvfdvrlaqme
    inpggtlelgvdygranlrdnyrlvdgaskdgwlftaehtqsvlkgfnkfvvqyatdsmt
    sqgkglsqgsgvafdnekfayninnnghmlrildhgaismgdnwdmmyvgmyqdinwdnd
    ngtkwwtvgirpmykwtpimstvmeigydnvesqrtgdknnqykitlaqqwqagdsiwsr
    pairvfatyakwdekwgydytgnadnnanfgkavpadfnggsfgrgdsdewtfgaqmeiw
    w