PDB entry 1af5

View 1af5 on RCSB PDB site
Description: group i mobile intron endonuclease
Deposited on 1997-03-21, released 1997-07-23
The last revision prior to the SCOP 1.69 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1af5__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1af5_ (-)
kynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwflgklvdeig
vgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlplevctwvdqi
aalnds