PDB entry 1af3

View 1af3 on RCSB PDB site
Description: rat bcl-xl an apoptosis inhibitory protein
Class: regulatory protein
Keywords: bcl-xl, apoptosis, mitochondrion, alternative splicing, regulatory protein
Deposited on 1997-03-21, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis regulator bcl-x
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1af3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1af3A (A:)
    msqsnrelvvdflsyklsqkgyswsqfsdveenrteapeeteperetpsaingnpswhla
    dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
    qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaswmatylndhlep
    wiqenggwdtfvdlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1af3A (A:)
    sqsnrelvvdflsyklsqkgyswsqfsdvipmaavkqalreagdefelryrrafsdltsq
    lhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaswma
    tylndhlepwiqenggwdtfvdlyg