PDB entry 1af2

View 1af2 on RCSB PDB site
Description: crystal structure of cytidine deaminase complexed with uridine
Class: complex (hydrolase/product)
Keywords: DEAMINASE, PROTON TRANSFER, STRAIN, PRODUCT RELEASE, HYDROLASE, COMPLEX (HYDROLASE-PRODUCT), COMPLEX (HYDROLASE-PRODUCT) complex
Deposited on 1997-03-20, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1af2a1, d1af2a2
  • Heterogens: ZN, U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1af2A (A:)
    mhprfqtafaqladnlqsalepiladkyfpalltgeqvsslksatgldedalafallpla
    aacartplsnfnvgaiargvsgtwyfganmefigatmqqtvhaeqsaishawlsgekala
    aitvnytpcghcrqfmnelnsgldlrihlpgreahalrdylpdafgpkdleiktllmdeq
    dhgyaltgdalsqaaiaaanrshmpyskspsgvaleckdgrifsgsyaenaafnptlppl
    qgalillnlkgydypdiqravlaekadapliqwdatsatlkalgchsidrvlla