PDB entry 1aey

View 1aey on RCSB PDB site
Description: alpha-spectrin src homology 3 domain, solution nmr, 15 structures
Deposited on 1997-03-02, released 1997-05-15
The last revision prior to the SCOP 1.69 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1aey__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1aey_ (-)
    mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aey_ (-)
    gkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld