PDB entry 1aey

View 1aey on RCSB PDB site
Description: alpha-spectrin src homology 3 domain, solution nmr, 15 structures
Class: cytoskeleton
Keywords: cytoskeleton, capping protein, calcium-binding, duplication, repeat, sh3 domain
Deposited on 1997-03-02, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-spectrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aeya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aeyA (A:)
    mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aeyA (A:)
    gkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld