PDB entry 1aew

View 1aew on RCSB PDB site
Description: l-chain horse apoferritin
Deposited on 1997-02-26, released 1997-09-04
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1aew__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aew_ (-)
    sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
    aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
    dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl