PDB entry 1aet

View 1aet on RCSB PDB site
Description: variation in the strength of a ch to o hydrogen bond in an artificial protein cavity (1-methylimidazole)
Deposited on 1997-02-25, released 1997-09-04
The last revision prior to the SCOP 1.69 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1aet__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1aet_ (-)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aet_ (-)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl