PDB entry 1aer

View 1aer on RCSB PDB site
Description: domain iii of pseudomonas aeruginosa exotoxin complexed with beta-tad
Deposited on 1995-12-11, released 1996-06-10
The last revision prior to the SCOP 1.59 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1aera_
  • Chain 'B':
    Domains in SCOP 1.59: d1aerb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aerA (A:)
    aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvraa
    iwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltlaapeaa
    geverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnvggdldp
    ssipdkeqaisalpdyasqpgkppr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aerB (B:)
    flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrars
    qdldaiwrgfyiagdpalaygyaqdqepdrgrirngallrvyvprsslpgfyrtsltlaa
    peaageverlighplplrldaitgprletilgwplaertvvipsaiptdprnvggdldps
    sipdkeqaisalpdy