PDB entry 1aep

View 1aep on RCSB PDB site
Description: molecular structure of an apolipoprotein determined at 2.5-angstroms resolution
Class: lipoprotein
Keywords: lipoprotein
Deposited on 1992-11-30, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipophorin III
    Species: Locusta migratoria [TaxId:7004]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aepa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aepA (A:)
    aaghvniaeavqqlnhtivnaahelhetlglptpdealnllteqanafktkiaevttslk
    qeaekhqgsvaeqlnafarnlnnsihdaatslnlqdqlnslqsaltnvghqwqdiatktq
    asaqeawapvqsalqeaaektkeaaanlqnsiqsavqkpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aepA (A:)
    niaeavqqlnhtivnaahelhetlglptpdealnllteqanafktkiaevttslkqeaek
    hqgsvaeqlnafarnlnnsihdaatslnlqdqlnslqsaltnvghqwqdiatktqasaqe
    awapvqsalqeaaektkeaaanlqnsiqsavqk