PDB entry 1ael

View 1ael on RCSB PDB site
Description: nmr structure of apo intestinal fatty acid-binding protein, 20 structures
Class: lipid-binding protein
Keywords: fatty acid-binding protein, lipid transport, I-fabp, lipid-binding protein
Deposited on 1996-07-30, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fatty acid-binding protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02693 (0-130)
  Domains in SCOPe 2.08: d1aela_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aelA (A:)
  afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidv
  vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
  gveakrifkke