PDB entry 1ael

View 1ael on RCSB PDB site
Description: nmr structure of apo intestinal fatty acid-binding protein, 20 structures
Class: lipid-binding protein
Keywords: fatty acid-binding protein, lipid transport, I-fabp, lipid-binding protein
Deposited on 1996-07-30, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid-binding protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aela_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aelA (A:)
    afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidv
    vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
    gveakrifkke