PDB entry 1aei

View 1aei on RCSB PDB site
Description: crystal structure of the annexin xii hexamer
Class: calcium/phospholipid-binding
Keywords: calcium/phospholipid-binding, annexin, calcium, phospholipid
Deposited on 1995-09-23, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin xii
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aeia_
  • Chain 'B':
    Compound: annexin xii
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aeib_
  • Chain 'C':
    Compound: annexin xii
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aeic_
  • Chain 'D':
    Compound: annexin xii
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aeid_
  • Chain 'E':
    Compound: annexin xii
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aeie_
  • Chain 'F':
    Compound: annexin xii
    Species: Hydra vulgaris [TaxId:6087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aeif_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aeiA (A:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aeiB (B:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aeiC (C:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aeiD (D:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aeiE (E:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aeiF (F:)
    vvqgtvkphasfnsredaetlrkamkgigtdeksithilatrsnaqrqqiktdyttlfgk
    hledelkselsgnyeaaalallrkpdeflaeqlhaamkglgtdenalidilctqsnaqih
    aikaafkllykedlekeiisetsgnfqrllvsmlqggrkedepvnaahaaedaaaiyqag
    egqigtdesrfnavlatrsypqlhqifheyskisnktilqaienefsgdikngllaivks
    venrfayfaerlhhamkglgtsdktlirilvsrseidlaniketfqamygkslyefiadd
    csgdykdlllqitgh