PDB entry 1aed

View 1aed on RCSB PDB site
Description: specificity of ligand binding to a buried polar cavity at the active site of cytochrome c peroxidase (3,4-dimethylthiazole)
Class: oxidoreductase
Keywords: oxidoreductase, peroxidase, transit peptide
Deposited on 1997-02-24, released 1997-09-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (3-293)
      • strain (52)
      • strain (151)
      • engineered (190)
      • conflict (271)
    Domains in SCOPe 2.06: d1aeda_
  • Heterogens: HEM, DTI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aedA (A:)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aedA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl