PDB entry 1aec

View 1aec on RCSB PDB site
Description: crystal structure of actinidin-e-64 complex+
Class: hydrolase
Keywords: hydrolase
Deposited on 1992-02-05, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.145
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actinidin
    Species: Actinidia chinensis [TaxId:3625]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00785 (0-217)
      • conflict (99)
      • conflict (145)
    Domains in SCOPe 2.07: d1aeca_
  • Heterogens: E64, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aecA (A:)
    lpsyvdwrsagavvdiksqgecggcwafsaiatveginkivtgvlislseqelidcgrtq
    ntrgcnggyitdgfqfiinngginteenypytaqdgecnvdlqnekyvtidtyenvpynn
    ewalqtavtyqpvsvaldaagdafkqyssgiftgpcgtaidhavtivgygteggidywiv
    knswdttwgeegymrilrnvggagtcgiatmpsypvky