PDB entry 1ae9

View 1ae9 on RCSB PDB site
Description: structure of the lambda integrase catalytic core
Class: DNA recombination
Keywords: DNA recombination, integrase, site-specific recombination
Deposited on 1997-03-06, released 1997-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lambda integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03700 (0-178)
      • engineered (165)
      • conflict (165)
    Domains in SCOPe 2.07: d1ae9a_
  • Chain 'B':
    Compound: lambda integrase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ae9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ae9A (A:)
    rsrltadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqskt
    gvkiaiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkas
    glsfegdpptfhelrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkiei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ae9A (A:)
    rsrltadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqskt
    gvkiaiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkas
    glsfegdpptfhelrslsarlyekqisdkfaqhllghkfrddrgrewdkiei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ae9B (B:)
    rsrltadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqskt
    gvkiaiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkas
    glsfegdpptfhelrslsarlyekqisdkfaqhllghksdtmasqfrddrgrewdkiei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ae9B (B:)
    rsrltadeylkiyqaaesspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqskt
    gvkiaiptalhidalgismketldkckeilggetiiastrreplssgtvsryfmrarkas
    glsfegdpptfhelrslsarlyekqisdkfaqhllghkswdkiei