PDB entry 1ae7

View 1ae7 on RCSB PDB site
Description: notexin, a presynaptic neurotoxic phospholipase a2
Deposited on 1997-03-06, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ae7__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ae7_ (-)
nlvqfsyliqcanhgkrptwhymdygcycgaggsgtpvdeldrcckihddcydeagkkgc
fpkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq