PDB entry 1ae5

View 1ae5 on RCSB PDB site
Description: human heparin binding protein
Class: serine protease homolog
Keywords: serine protease homolog, endotoxin binding, heparin binding, inflammation, antibacterial, cap37, azurocidin, glycosylated protein
Deposited on 1997-03-05, released 1998-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ae5a_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ae5A (A:)
    ivggrkarprqfpflasiqnqgrhfcggaliharfvmtaascfqsqnpgvstvvlgaydl
    rrrerqsrqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveag
    trcqvagwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdggtplv
    ceglahgvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ae5A (A:)
    ivggrkarprqfpflasiqnqgrhfcggaliharfvmtaascfqspgvstvvlgaydlrr
    rerqsrqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveagtr
    cqvagwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdggtplvce
    glahgvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa