PDB entry 1ae3

View 1ae3 on RCSB PDB site
Description: mutant r82c of gene v protein (single-stranded DNA binding protein)
Class: DNA-binding protein
Keywords: mutant, r82c, gvp, single-stranded DNA binding protein, DNA replication, DNA-binding protein
Deposited on 1997-03-04, released 1997-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gene v protein
    Species: Escherichia coli [TaxId:562]
    Gene: GEN V IN BACTERIOPHAGE F1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69543 (0-85)
      • engineered (81)
    Domains in SCOPe 2.07: d1ae3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ae3A (A:)
    mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgl
    ytvhlssfkvgqfgslmidrlclvpa