PDB entry 1ae1

View 1ae1 on RCSB PDB site
Description: tropinone reductase-I complex with nadp
Class: oxidoreductase
Keywords: oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase
Deposited on 1997-10-23, released 1998-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.155
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tropinone reductase-I
    Species: Datura stramonium [TaxId:4076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ae1a_
  • Chain 'B':
    Compound: tropinone reductase-I
    Species: Datura stramonium [TaxId:4076]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ae1b_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ae1A (A:)
    meeskvsmmncnnegrwslkgttalvtggskgigyaiveelaglgarvytcsrnekelde
    cleiwrekglnvegsvcdllsrterdklmqtvahvfdgklnilvnnagvvihkeakdfte
    kdyniimgtnfeaayhlsqiaypllkasqngnviflssiagfsalpsvslysaskgainq
    mtkslacewakdnirvnsvapgviltplvetaikknphqkeeidnfivktpmgragkpqe
    vsaliaflcfpaasyitgqiiwadggftanggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ae1A (A:)
    rwslkgttalvtggskgigyaiveelaglgarvytcsrnekeldecleiwrekglnvegs
    vcdllsrterdklmqtvahvfdgklnilvnnagvvihkeakdftekdyniimgtnfeaay
    hlsqiaypllkasqngnviflssiagfsalpsvslysaskgainqmtkslacewakdnir
    vnsvapgvilqkeeidnfivktpmgragkpqevsaliaflcfpaasyitgqiiwadggft
    anggf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ae1B (B:)
    meeskvsmmncnnegrwslkgttalvtggskgigyaiveelaglgarvytcsrnekelde
    cleiwrekglnvegsvcdllsrterdklmqtvahvfdgklnilvnnagvvihkeakdfte
    kdyniimgtnfeaayhlsqiaypllkasqngnviflssiagfsalpsvslysaskgainq
    mtkslacewakdnirvnsvapgviltplvetaikknphqkeeidnfivktpmgragkpqe
    vsaliaflcfpaasyitgqiiwadggftanggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ae1B (B:)
    rwslkgttalvtggskgigyaiveelaglgarvytcsrnekeldecleiwrekglnvegs
    vcdllsrterdklmqtvahvfdgklnilvnnagvvihkeakdftekdyniimgtnfeaay
    hlsqiaypllkasqngnviflssiagfsalpsvslysaskgainqmtkslacewakdnir
    vnsvapgviltplvetaikknphqkeeidnfivktpmgragkpqevsaliaflcfpaasy
    itgqiiwadggftanggf