PDB entry 1adz

View 1adz on RCSB PDB site
Description: the solution structure of the second kunitz domain of tissue factor pathway inhibitor, nmr, 30 structures
Deposited on 1997-02-19, released 1998-02-25
The last revision prior to the SCOP 1.59 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1adz__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1adz_ (-)
  dykddddklkpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleec
  knicedgpngf