PDB entry 1adz

View 1adz on RCSB PDB site
Description: the solution structure of the second kunitz domain of tissue factor pathway inhibitor, nmr, 30 structures
Class: hydrolase
Keywords: hydrolase, inhibitor, coagulation
Deposited on 1997-02-19, released 1998-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tissue factor pathway inhibitor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10646 (0-70)
    • engineered (1)
    • conflict (2)
    • engineered (3-6)
  Domains in SCOPe 2.08: d1adza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1adzA (A:)
  dykddddklkpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleec
  knicedgpngf