PDB entry 1adw

View 1adw on RCSB PDB site
Description: pseudoazurin
Deposited on 1997-02-18, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1adwa_
  • Chain 'B':
    Domains in SCOP 1.55: d1adwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adwA (A:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
    qvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adwB (B:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
    qvn