PDB entry 1adw

View 1adw on RCSB PDB site
Description: pseudoazurin
Class: electron transport
Keywords: copper, electron transport, cuproprotein
Deposited on 1997-02-18, released 1997-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.189
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1adwa_
  • Chain 'B':
    Compound: pseudoazurin
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1adwb_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adwA (A:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
    qvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adwB (B:)
    athevhmlnkgesgamvfepafvraepgdvinfvptdkshnveaikeilpegvesfkski
    nesytltvtepglygvkctphfgmgmvglvqvgdapenldaaktakmpkkarermdaela
    qvn