PDB entry 1adv

View 1adv on RCSB PDB site
Description: early e2a DNA-binding protein
Class: DNA-binding protein
Keywords: DNA-binding protein, ssDNA binding protein
Deposited on 1995-05-12, released 1996-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.206
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenovirus single-stranded DNA-binding protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1adva1, d1adva2, d1adva3
  • Chain 'B':
    Compound: adenovirus single-stranded DNA-binding protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1advb1, d1advb2, d1advb3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1advA (A:)
    svpivsawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqlt
    ftsnktfvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsimink
    ehviemdvtsengqralkeqsskakivknrwgrnvvqisntdarccvhdaacpanqfsgk
    scgmffsegakaqvafkqikafmqalypnaqtghghllmplrcecnskpghapflgrqlp
    kltpfalsnaedldadlisdksvlasvhhpalivfqccnpvyrnsraqgggpncdfkisa
    pdllnalvmvrslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpfdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1advA (A:)
    awekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnkt
    fvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsiminkdarccv
    hdaacpanqfsgkscgmffsegakaqvafkqikafmqalypnaqtghghllmplrcecns
    pflgrqlpkltpfalsnaedldksvlasvhhpalivfqccnppncdfkisapdllnalvm
    vrslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpfdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1advB (B:)
    svpivsawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqlt
    ftsnktfvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsimink
    ehviemdvtsengqralkeqsskakivknrwgrnvvqisntdarccvhdaacpanqfsgk
    scgmffsegakaqvafkqikafmqalypnaqtghghllmplrcecnskpghapflgrqlp
    kltpfalsnaedldadlisdksvlasvhhpalivfqccnpvyrnsraqgggpncdfkisa
    pdllnalvmvrslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpfdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1advB (B:)
    awekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnkt
    fvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsimindarccvh
    dafsgkscgmffsegakaqvafkqikafmqalypnaqtghghllmplrcecnspflgrql
    pkltpfalsnaedldadlisdksvlasvhhpalivfqccnppncdfkisapdllnalvmv
    rslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpfdf