PDB entry 1adu

View 1adu on RCSB PDB site
Description: early e2a DNA-binding protein
Class: DNA-binding protein
Keywords: DNA-binding protein, ssDNA binding protein
Deposited on 1995-05-11, released 1996-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.201
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenovirus single-stranded DNA-binding protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03265 (Start-355)
      • conflict (63)
    Domains in SCOPe 2.07: d1adua1, d1adua2, d1adua3
  • Chain 'B':
    Compound: adenovirus single-stranded DNA-binding protein
    Species: Human adenovirus 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03265 (Start-355)
      • conflict (63)
    Domains in SCOPe 2.07: d1adub1, d1adub2, d1adub3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aduA (A:)
    svpivsawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqlt
    ftsnktfvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsimink
    ehviemdvtsengqralkeqsskakivknrwgrnvvqisntdarccvhdaacpanqfsgk
    scgmffsegakaqvafkqikafmqalypnaqtghghllmplrcecnskpghapflgrqlp
    kltpfalsnaedldadlisdksvlasvhhpalivfqccnpvyrnsraqgggpncdfkisa
    pdllnalvmvrslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpfdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aduA (A:)
    awekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnkt
    fvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsiminkdarccv
    hdaacpanqfsgkscgmffsegakaqvafkqikafmqalypnaqtghghllmplrcecns
    pflgrqlpkltpfalsnaedldksvlasvhhpalivfqccnppncdfkisapdllnalvm
    vrslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpfdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aduB (B:)
    svpivsawekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqlt
    ftsnktfvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsimink
    ehviemdvtsengqralkeqsskakivknrwgrnvvqisntdarccvhdaacpanqfsgk
    scgmffsegakaqvafkqikafmqalypnaqtghghllmplrcecnskpghapflgrqlp
    kltpfalsnaedldadlisdksvlasvhhpalivfqccnpvyrnsraqgggpncdfkisa
    pdllnalvmvrslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpfdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aduB (B:)
    awekgmeaaralmdkyhvdndlkanfkllpdqvealaavcktwlneehrglqltftsnkt
    fvtmmgrflqaylqsfaevtykhheptgcalwlhrcaeiegelkclhgsimindarccvh
    dafsgkscgmffsegakaqvafkqikafmqalypnaqtghghllmplrcecnspflgrql
    pkltpfalsnaedldadlisdksvlasvhhpalivfqccnppncdfkisapdllnalvmv
    rslwsenftelprmvvpefkwstkhqyrnvslpvahsdarqnpfdf