PDB entry 1ads

View 1ads on RCSB PDB site
Description: an unlikely sugar substrate site in the 1.65 angstroms structure of the human aldose reductase holoenzyme implicated in diabetic complications
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1992-07-08, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.2
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1adsa_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adsA (A:)
    asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
    klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
    ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
    vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
    nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
    lsctshkdypfheef