PDB entry 1adr

View 1adr on RCSB PDB site
Description: determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor
Deposited on 1993-07-19, released 1994-01-31
The last revision prior to the SCOP 1.71 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1adr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adr_ (-)
    mntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcs
    pdyllkgdlsqtnvay