PDB entry 1adq

View 1adq on RCSB PDB site
Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
Class: complex (immunoglobulin/autoantigen)
Keywords: complex (immunoglobulin/autoantigen), rheumatoid factor auto-antibody complex
Deposited on 1997-02-18, released 1998-09-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg4 rea fc
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01861 (0-205)
      • conflict (34)
      • conflict (45)
      • conflict (56)
      • conflict (74)
      • conflict (77)
    Domains in SCOPe 2.01: d1adqa1, d1adqa2
  • Chain 'H':
    Compound: igm-lambda rf-an fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1ADQ (0-222)
    Domains in SCOPe 2.01: d1adqh1, d1adqh2
  • Chain 'L':
    Compound: igm-lambda rf-an fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1ADQ (0-212)
    Domains in SCOPe 2.01: d1adql1, d1adql2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adqA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvsqedpqvqfnwyvdgvqvhnaktkpreqqfn
    styrvvsvltvlhqnwldgkeykckvsnkglpssiektiskakgqprepqvytlppsqee
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysrltvdksrw
    qegnvfscsvmhealhnhytqkslsl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adqH (H:)
    evqlvesggglvqpgrslrlscvtsgftfddyamhwvrqspgkglewvsgiswntgtiiy
    adsvkgrfiisrdnaknslylqmnslrvedtalyycaktrsyvvaaeyyfhywgqgilvt
    vssgsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfps
    vlrggkyaatsqvllpskdvmqgtnehvvckvqhpngnkekdvpl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adqL (L:)
    yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrppgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhavfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadgspvkagvetttpskqsnnkyaassyls
    ltpeqwkshksyscqvthegstvektvaptecs