PDB entry 1adn

View 1adn on RCSB PDB site
Description: solution structure of the DNA methylphosphotriester repair domain of escherichia coli ada
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1993-09-30, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: n-ada 10
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06134 (0-91)
  Domains in SCOPe 2.08: d1adna_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1adnA (A:)
  mkkatcltddqrwqsvlardpnadgefvfavrttgifcrpscrarhalrenvsfyanase
  alaagfrpckrcqpdkanprqhrldkithacr