PDB entry 1adn

View 1adn on RCSB PDB site
Description: solution structure of the DNA methylphosphotriester repair domain of escherichia coli ada
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1993-09-30, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-ada 10
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1adna_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1adnA (A:)
    mkkatcltddqrwqsvlardpnadgefvfavrttgifcrpscrarhalrenvsfyanase
    alaagfrpckrcqpdkanprqhrldkithacr