PDB entry 1adm

View 1adm on RCSB PDB site
Description: three-dimensional structure of the adenine-specific dna methyltransferase m.taq i in complex with the cofactor s-adenosylmethionine
Deposited on 1994-03-02, released 1995-10-18
The last revision was dated 1995-10-18, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenine-n6-DNA-methyltransferase taqi
    Species: THERMUS AQUATICUS
  • Chain 'B':
    Compound: adenine-n6-DNA-methyltransferase taqi
    Species: THERMUS AQUATICUS
  • Heterogens: SAM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1admA (A:)
    mglppllslpsnsaprslgrvetppevvdfmvslaeaprggrvlepacahgpflrafrea
    hgtgyrfvgveidpkaldlppwaegiladfllwepgeafdlilgnppygivgeaskypih
    vfkavkdlykkafstwkgkynlygaflekavrllkpggvlvfvvpatwlvledfallref
    laregktsvyylgevfpqkkvsavvirfqksgkglslwdtqesesgftpilwaeyphweg
    eiirfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkp
    gwvdyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllp
    kegvrldpstlvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhtspesarn
    f
    

    Sequence, based on observed residues (ATOM records):
    >1admA (A:)
    mglppllslpsnsaprsvetppevvdfmvslaeaprggrvlepacahgpflrafreahgt
    gyrfvgveidpkaldlppwaegiladfllwepgeafdlilgnppygivgeapihvfkavk
    dlykkafstwkgkynlygaflekavrllkpggvlvfvvpatwlvledfallreflaregk
    tsvyylgevfpqkkvsavvirfqksgkglslwdtqesesgftpilwaeyphwegeiirfe
    teetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwvdye
    knhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkegvrl
    dpstlvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhtspesarnf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1admB (B:)
    mglppllslpsnsaprslgrvetppevvdfmvslaeaprggrvlepacahgpflrafrea
    hgtgyrfvgveidpkaldlppwaegiladfllwepgeafdlilgnppygivgeaskypih
    vfkavkdlykkafstwkgkynlygaflekavrllkpggvlvfvvpatwlvledfallref
    laregktsvyylgevfpqkkvsavvirfqksgkglslwdtqesesgftpilwaeyphweg
    eiirfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkp
    gwvdyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllp
    kegvrldpstlvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhtspesarn
    f
    

    Sequence, based on observed residues (ATOM records):
    >1admB (B:)
    mglppllslpsnsaprsvetppevvdfmvslaeaprggrvlepacahgpflrafreahgt
    gyrfvgveidpkaldlppwaegiladfllwepgeafdlilgnppygivgeapihvfkavk
    dlykkafstwkgkynlygaflekavrllkpggvlvfvvpatwlvledfallreflaregk
    tsvyylgevfpqkkvsavvirfqksgkglslwdtqesesgftpilwaeyphwegeiirfe
    teetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwvdye
    knhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkegvrl
    dpstlvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhtspesarnf