PDB entry 1adk

View 1adk on RCSB PDB site
Description: transferase(phospho)phosphoryl acceptor
Deposited on 1976-06-11, released 1976-06-11
The last revision was dated 1976-06-11, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1adk_ (-)
meeklkkskiifvvggpgsgkgtqcekivqkygythlstgdllraevssgsargkmlsei
mekgqlvpletvldmlrdamvakvdtskgflidgyprevkqgeeferkigqptlllyvda
gpetmtkrllkrgetsgrvddneetikkrletyykatepviafyekrgivrkvnaegsvd
dvfsqvcthldtlk

  • Chain 'p':
    No sequence available.