PDB entry 1adj

View 1adj on RCSB PDB site
Description: histidyl-tRNA synthetase in complex with histidine
Class: complex (tRNA synthetase/peptide)
Keywords: amino acid, histidine, complex (tRNA synthetase/peptide)
Deposited on 1997-02-18, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1adja1, d1adja2
  • Chain 'B':
    Compound: histidyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1adjb1, d1adjb2
  • Chain 'C':
    Compound: histidyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1adjc1, d1adjc2
  • Chain 'D':
    Compound: histidyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1adjd1, d1adjd2
  • Heterogens: SO4, HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1adjA (A:)
    mtaravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdi
    vrkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgr
    yrqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylr
    evlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkev
    erhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprv
    pgvgfafgvervalaleaegfglpeekgpdlyliplteeavaeafylaealrprlraeya
    laprkpakgleealkrgaafagflgedelragevtlkrlatgeqvrlsreevpgyllqal
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1adjA (A:)
    taravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdiv
    rkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgry
    rqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylre
    vlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkeve
    rhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprvp
    gvgfafgvervalaleaegfglpeekgpdlyliplteeavaeafylaealrprlraeyal
    aprkpakgleealkrgaafagflgedelragevtlkrlatgeqvrlsreevpgyllqalg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1adjB (B:)
    mtaravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdi
    vrkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgr
    yrqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylr
    evlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkev
    erhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprv
    pgvgfafgvervalaleaegfglpeekgpdlyliplteeavaeafylaealrprlraeya
    laprkpakgleealkrgaafagflgedelragevtlkrlatgeqvrlsreevpgyllqal
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1adjB (B:)
    taravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdiv
    rkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgry
    rqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylre
    vlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkeve
    rhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprvp
    gvgfafgvervalaleaegfglpeekgpdlyliplteeavaeafylaealrprlraeyal
    aprkpakgleealkrgaafagflgedelragevtlkrlatgeqvrlsreevpgyllqalg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1adjC (C:)
    mtaravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdi
    vrkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgr
    yrqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylr
    evlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkev
    erhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprv
    pgvgfafgvervalaleaegfglpeekgpdlyliplteeavaeafylaealrprlraeya
    laprkpakgleealkrgaafagflgedelragevtlkrlatgeqvrlsreevpgyllqal
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1adjC (C:)
    taravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdiv
    rkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgry
    rqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylre
    vlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkeve
    rhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprvp
    gvgfafgvervalaleaegfglpeekgpdlyliplteeavaeafylaealrprlraeyal
    aprkpakgleealkrgaafagflgedelragevtlkrlatgeqvrlsreevpgyllqalg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1adjD (D:)
    mtaravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdi
    vrkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgr
    yrqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylr
    evlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkev
    erhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprv
    pgvgfafgvervalaleaegfglpeekgpdlyliplteeavaeafylaealrprlraeya
    laprkpakgleealkrgaafagflgedelragevtlkrlatgeqvrlsreevpgyllqal
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1adjD (D:)
    taravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdiv
    rkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgry
    rqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylre
    vlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkeve
    rhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprvp
    gvgfafgvervalaleaegfglpeekgpdlyliplteeavaeafylaealrprlraeyal
    aprkpakgleealkrgaafagflgedelragevtlkrlatgeqvrlsreevpgyllqalg