PDB entry 1ada

View 1ada on RCSB PDB site
Description: atomic structure of adenosine deaminase complexed with a transition-*state analog: understanding catalysis and immunodeficiency mutations
Deposited on 1991-04-25, released 1992-01-15
The last revision was dated 1995-03-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: ZN, HPR

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1ada_ (-)
    maqtpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpg
    flakfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqt
    egdvtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvam
    dlagdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgy
    htiedealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplif
    kstldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

    Sequence, based on observed residues (ATOM records):
    >1ada_ (-)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
    

  • Chain 'p':
    No sequence available.