PDB entry 1ad9

View 1ad9 on RCSB PDB site
Description: igg-fab fragment of engineered human monoclonal antibody ctm01
Class: immunoglobulin
Keywords: immunoglobulin, fab fragment
Deposited on 1997-02-24, released 1998-02-25
The last revision prior to the SCOP 1.75 freeze date was dated 1998-02-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg ctm01 fab (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB AAA87674 (2-218)
      • conflict (24)
      • conflict (26)
      • insertion (26)
      • conflict (26)
      • insertion (32-34)
      • conflict (35-36)
      • conflict (38)
      • conflict (40)
      • conflict (52)
      • conflict (54-55)
      • conflict (57)
      • conflict (59)
      • conflict (80)
      • conflict (91)
      • insertion (93)
      • conflict (96-98)
      • conflict (100)
      • conflict (110)
    Domains in SCOP 1.75: d1ad9a1, d1ad9a2
  • Chain 'B':
    Compound: igg ctm01 fab (heavy chain)
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1ad9b1, d1ad9b2
  • Chain 'H':
    Compound: igg ctm01 fab (heavy chain)
    Species: HOMO SAPIENS
    Domains in SCOP 1.75: d1ad9h1, d1ad9h2
  • Chain 'L':
    Compound: igg ctm01 fab (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • GB AAA87674 (2-218)
      • conflict (24)
      • conflict (26)
      • insertion (26)
      • conflict (26)
      • insertion (32-34)
      • conflict (35-36)
      • conflict (38)
      • conflict (40)
      • conflict (52)
      • conflict (54-55)
      • conflict (57)
      • conflict (59)
      • conflict (80)
      • conflict (91)
      • insertion (93)
      • conflict (96-98)
      • conflict (100)
      • conflict (110)
    Domains in SCOP 1.75: d1ad9l1, d1ad9l2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad9A (A:)
    diqmtqspstlsasvgdrvtitcrssksllhsngdtflywfqqkpgkapkllmyrmsnla
    sgvpsrfsgsgsgteftltisslqpddfatyycmqhleypftfgqgtkvevkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad9B (B:)
    eiqlvqsgaevkkpgssvkvsckasgytftdyyinwmrqapgqglewigwidpgsgntky
    nekfkgratltvdtstntaymelsslrsedtafyfcarekttyyyamdywgqgtlvtvss
    astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad9H (H:)
    eiqlvqsgaevkkpgssvkvsckasgytftdyyinwmrqapgqglewigwidpgsgntky
    nekfkgratltvdtstntaymelsslrsedtafyfcarekttyyyamdywgqgtlvtvss
    astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad9L (L:)
    diqmtqspstlsasvgdrvtitcrssksllhsngdtflywfqqkpgkapkllmyrmsnla
    sgvpsrfsgsgsgteftltisslqpddfatyycmqhleypftfgqgtkvevkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec