PDB entry 1ad9

View 1ad9 on RCSB PDB site
Description: igg-fab fragment of engineered human monoclonal antibody ctm01
Deposited on 1997-02-24, released 1998-02-25
The last revision prior to the SCOP 1.65 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad9A (A:)
    diqmtqspstlsasvgdrvtitcrssksllhsngdtflywfqqkpgkapkllmyrmsnla
    sgvpsrfsgsgsgteftltisslqpddfatyycmqhleypftfgqgtkvevkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad9B (B:)
    eiqlvqsgaevkkpgssvkvsckasgytftdyyinwmrqapgqglewigwidpgsgntky
    nekfkgratltvdtstntaymelsslrsedtafyfcarekttyyyamdywgqgtlvtvss
    astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad9H (H:)
    eiqlvqsgaevkkpgssvkvsckasgytftdyyinwmrqapgqglewigwidpgsgntky
    nekfkgratltvdtstntaymelsslrsedtafyfcarekttyyyamdywgqgtlvtvss
    astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad9L (L:)
    diqmtqspstlsasvgdrvtitcrssksllhsngdtflywfqqkpgkapkllmyrmsnla
    sgvpsrfsgsgsgteftltisslqpddfatyycmqhleypftfgqgtkvevkrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec