PDB entry 1ad6

View 1ad6 on RCSB PDB site
Description: domain a of human retinoblastoma tumor suppressor
Class: transcription regulation
Keywords: transcription regulation, tumor suppressor, DNA-binding
Deposited on 1997-02-21, released 1998-08-26
The last revision prior to the SCOP 1.73 freeze date was dated 1998-08-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinoblastoma tumor suppressor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ad6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad6A (A:)
    vmntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqg
    cveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmat
    ysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehri
    mesla