PDB entry 1ad6

View 1ad6 on RCSB PDB site
Description: domain a of human retinoblastoma tumor suppressor
Deposited on 1997-02-21, released 1998-08-26
The last revision prior to the SCOP 1.71 freeze date was dated 1998-08-26, with a file datestamp of 1998-08-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1ad6__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ad6_ (-)
    vmntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqg
    cveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmat
    ysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehri
    mesla